Lineage for d1jdbk1 (1jdb K:403-555)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 445866Fold a.92: Carbamoyl phosphate synthetase, large subunit connection domain [48107] (1 superfamily)
    multihelical; consists of two all-alpha subdomains
    possible duplication: subdomains have similar topologies
  4. 445867Superfamily a.92.1: Carbamoyl phosphate synthetase, large subunit connection domain [48108] (1 family) (S)
  5. 445868Family a.92.1.1: Carbamoyl phosphate synthetase, large subunit connection domain [48109] (1 protein)
  6. 445869Protein Carbamoyl phosphate synthetase, large subunit connection domain [48110] (1 species)
  7. 445870Species Escherichia coli [TaxId:562] [48111] (10 PDB entries)
  8. 445886Domain d1jdbk1: 1jdb K:403-555 [18577]
    Other proteins in same PDB: d1jdbb2, d1jdbb3, d1jdbb4, d1jdbb5, d1jdbb6, d1jdbc1, d1jdbc2, d1jdbe2, d1jdbe3, d1jdbe4, d1jdbe5, d1jdbe6, d1jdbf1, d1jdbf2, d1jdbh2, d1jdbh3, d1jdbh4, d1jdbh5, d1jdbh6, d1jdbi1, d1jdbi2, d1jdbk2, d1jdbk3, d1jdbk4, d1jdbk5, d1jdbk6, d1jdbl1, d1jdbl2

Details for d1jdbk1

PDB Entry: 1jdb (more details), 2.1 Å

PDB Description: carbamoyl phosphate synthetase from escherichia coli

SCOP Domain Sequences for d1jdbk1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jdbk1 a.92.1.1 (K:403-555) Carbamoyl phosphate synthetase, large subunit connection domain {Escherichia coli}
vgatgfdpkvslddpealtkirrelkdagadriwyiadafraglsvdgvfnltnidrwfl
vqieelvrleekvaevgitglnadflrqlkrkgfadarlaklagvreaeirklrdqydlh
pvykrvdtcaaefatdtaymystyeeeceanps

SCOP Domain Coordinates for d1jdbk1:

Click to download the PDB-style file with coordinates for d1jdbk1.
(The format of our PDB-style files is described here.)

Timeline for d1jdbk1: