Lineage for d3tcoc_ (3tco C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2878967Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 2878968Protein automated matches [190056] (195 species)
    not a true protein
  7. 2880360Species Sulfolobus solfataricus [TaxId:2287] [188853] (4 PDB entries)
  8. 2880363Domain d3tcoc_: 3tco C: [185767]
    automated match to d1nw2a_
    complexed with edo

Details for d3tcoc_

PDB Entry: 3tco (more details), 1.9 Å

PDB Description: Crystallographic and spectroscopic characterization of Sulfolobus solfataricus TrxA1 provide insights into the determinants of thioredoxin fold stability
PDB Compounds: (C:) Thioredoxin (TrxA-1)

SCOPe Domain Sequences for d3tcoc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3tcoc_ c.47.1.0 (C:) automated matches {Sulfolobus solfataricus [TaxId: 2287]}
edvtlvlteenfdevirnnklvlvdcwaewcapchlyepiykkvaekykgkavfgrlnvd
enqkiadkysvlnipttlifvngqlvdslvgavdedtlestvnkyl

SCOPe Domain Coordinates for d3tcoc_:

Click to download the PDB-style file with coordinates for d3tcoc_.
(The format of our PDB-style files is described here.)

Timeline for d3tcoc_: