SCOPe 2.06: Domain d3tcoa_: 3tco A:

Lineage for d3tcoa_ (3tco A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (165 species)
   not a true protein

7. Species Sulfolobus solfataricus [TaxId:2287] [188853] (4 PDB entries)

8. Domain d3tcoa_: 3tco A: [185765]
   automated match to d1nw2a_
   complexed with edo

Details for d3tcoa_

PDB Entry: 3tco, 1.9 Å

PDB Description: Crystallographic and spectroscopic characterization of Sulfolobus solfataricus TrxA1 provide insights into the determinants of thioredoxin fold stability

PDB Compounds: (A:) Thioredoxin (TrxA-1)

SCOPe Domain Sequences for d3tcoa_:

Sequence; same for both SEQRES and ATOM records:

>d3tcoa_ c.47.1.0 (A:) automated matches {Sulfolobus solfataricus [TaxId: 2287]}
edvtlvlteenfdevirnnklvlvdcwaewcapchlyepiykkvaekykgkavfgrlnvd
enqkiadkysvlnipttlifvngqlvdslvgavdedtlestvnkyl

Timeline for d3tcoa_:

• d3tcoa_ first appeared in SCOPe 2.01
  
• d3tcoa_ appears in SCOPe 2.05
  
• d3tcoa_ appears in SCOPe 2.07
  
• d3tcoa_ appears in the current release, SCOPe 2.08