Lineage for d3tb2d_ (3tb2 D:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2877441Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins)
  6. 2877442Protein 1-Cys peroxiredoxin [52909] (3 species)
  7. 2877463Species Plasmodium yoelii yoelii [TaxId:73239] [117599] (2 PDB entries)
    Uniprot Q7RGR1
  8. 2877467Domain d3tb2d_: 3tb2 D: [185747]
    automated match to d1xcca_
    complexed with edo, gol, so4

Details for d3tb2d_

PDB Entry: 3tb2 (more details), 2.3 Å

PDB Description: 1-cys peroxidoxin from plasmodium yoelli
PDB Compounds: (D:) 1-Cys peroxiredoxin

SCOPe Domain Sequences for d3tb2d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3tb2d_ c.47.1.10 (D:) 1-Cys peroxiredoxin {Plasmodium yoelii yoelii [TaxId: 73239]}
gyhlgatfpnftakasgidgdfelykyienswailfshpndftpvcttelaelgkmhedf
lklnckligfscnskeshdkwiedikyygklnkweipivcdesrelanklkimdeqekdi
tglpltcrclffispekkikatvlypattgrnaheilrvlkslqltyttpvatpvnwneg
dkccviptlqddeiskhfkneitkvempskkkylrfvnl

SCOPe Domain Coordinates for d3tb2d_:

Click to download the PDB-style file with coordinates for d3tb2d_.
(The format of our PDB-style files is described here.)

Timeline for d3tb2d_: