SCOPe 2.06: Domain d3taob_: 3tao B:

Lineage for d3taob_ (3tao B:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (2 families)

5. Family c.1.1.0: automated matches [191424] (1 protein)
   not a true family

6. Protein automated matches [190605] (21 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:83332] [189828] (2 PDB entries)

8. Domain d3taob_: 3tao B: [185743]
   automated match to d1b9bb_
   complexed with pgh

Details for d3taob_

PDB Entry: 3tao, 1.45 Å

PDB Description: Structure of Mycobacterium tuberculosis triosephosphate isomerase bound to phosphoglycolohydroxamate

PDB Compounds: (B:) triosephosphate isomerase

SCOPe Domain Sequences for d3taob_:

Sequence; same for both SEQRES and ATOM records:

>d3taob_ c.1.1.0 (B:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
srkpliagnwkmnlnhyeaialvqkiafslpdkyydrvdvavippftdlrsvqtlvdgdk
lrltygaqdlsphdsgaytgdvsgaflaklgcsyvvvghserrtyhneddalvaakaata
lkhgltpivcigehldvreagnhvahnieqlrgslagllaeqigsvviayepvwaigtgr
vasaadaqevcaairkelaslaspriadtvrvlyggsvnaknvgdivaqddvdgglvgga
sldgehfatlaaiaaggp

Timeline for d3taob_:

• d3taob_ first appeared in SCOPe 2.01
  
• d3taob_ appears in SCOPe 2.05
  
• d3taob_ appears in SCOPe 2.07
  
• d3taob_ appears in the current release, SCOPe 2.08