![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (2 families) ![]() |
![]() | Family c.1.1.0: automated matches [191424] (1 protein) not a true family |
![]() | Protein automated matches [190605] (21 species) not a true protein |
![]() | Species Mycobacterium tuberculosis [TaxId:83332] [189828] (2 PDB entries) |
![]() | Domain d3taoa_: 3tao A: [185742] automated match to d1b9bb_ complexed with pgh |
PDB Entry: 3tao (more details), 1.45 Å
SCOPe Domain Sequences for d3taoa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3taoa_ c.1.1.0 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]} srkpliagnwkmnlnhyeaialvqkiafslpdkyydrvdvavippftdlrsvqtlvdgdk lrltygaqdlsphdsgaytgdvsgaflaklgcsyvvvghserrtyhneddalvaakaata lkhgltpivcigehldvreagnhvahnieqlrgslagllaeqigsvviayepvwaigtgr vasaadaqevcaairkelaslaspriadtvrvlyggsvnaknvgdivaqddvdgglvgga sldgehfatlaaiaag
Timeline for d3taoa_: