SCOPe 2.01: Domain d3ta6a_: 3ta6 A:

Lineage for d3ta6a_ (3ta6 A:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (2 families)

5. Family c.1.1.0: automated matches [191424] (1 protein)
   not a true family

6. Protein automated matches [190605] (2 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:83332] [189828] (2 PDB entries)

8. Domain d3ta6a_: 3ta6 A: [185739]
   automated match to d1b9bb_
   complexed with flc

Details for d3ta6a_

PDB Entry: 3ta6, 1.41 Å

PDB Description: Structure of Mycobacterium tuberculosis triosephosphate isomerase

PDB Compounds: (A:) triosephosphate isomerase

SCOPe Domain Sequences for d3ta6a_:

Sequence; same for both SEQRES and ATOM records:

>d3ta6a_ c.1.1.0 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
rkpliagnwkmnlnhyeaialvqkiafslpdkyydrvdvavippftdlrsvqtlvdgdkl
rltygaqdlsphdsgaytgdvsgaflaklgcsyvvvghserrtyhneddalvaakaatal
khgltpivcigehldvreagnhvahnieqlrgslagllaeqigsvviayepvwaigtgrv
asaadaqevcaairkelaslaspriadtvrvlyggsvnaknvgdivaqddvdgglvggas
ldgehfatlaaiaag

Timeline for d3ta6a_:

• d3ta6a_ is new in SCOPe 2.01-stable
  
• d3ta6a_ appears in SCOPe 2.02
  
• d3ta6a_ appears in the current release, SCOPe 2.08