Lineage for d3ta2b_ (3ta2 B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2950563Superfamily d.58.5: GlnB-like [54913] (6 families) (S)
    form timeric structures with the orthogonally packed beta-sheets
  5. 2950865Family d.58.5.0: automated matches [191474] (1 protein)
    not a true family
  6. 2950866Protein automated matches [190753] (21 species)
    not a true protein
  7. 2950886Species Archaeoglobus fulgidus [TaxId:224325] [189774] (4 PDB entries)
  8. 2950888Domain d3ta2b_: 3ta2 B: [185736]
    automated match to d1qy7a_
    complexed with akg, atp, mg, ni

Details for d3ta2b_

PDB Entry: 3ta2 (more details), 1.9 Å

PDB Description: A. fulgidus GlnK3, MgATP/2-OG complex
PDB Compounds: (B:) Nitrogen regulatory protein P-II (GlnB-3)

SCOPe Domain Sequences for d3ta2b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ta2b_ d.58.5.0 (B:) automated matches {Archaeoglobus fulgidus [TaxId: 224325]}
mkmvvavirpeklecvkkaleergfvgmtvtevkgrgeqkgirlqfrgrevevdllqktk
vevvvsddavdevveaivssartgkfgdgrifvipveksvkirtgdeev

SCOPe Domain Coordinates for d3ta2b_:

Click to download the PDB-style file with coordinates for d3ta2b_.
(The format of our PDB-style files is described here.)

Timeline for d3ta2b_: