| Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
| Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.5: GlnB-like [54913] (6 families) ![]() form timeric structures with the orthogonally packed beta-sheets |
| Family d.58.5.0: automated matches [191474] (1 protein) not a true family |
| Protein automated matches [190753] (21 species) not a true protein |
| Species Archaeoglobus fulgidus [TaxId:224325] [189774] (4 PDB entries) |
| Domain d3ta2a_: 3ta2 A: [185735] automated match to d1qy7a_ complexed with akg, atp, mg, ni |
PDB Entry: 3ta2 (more details), 1.9 Å
SCOPe Domain Sequences for d3ta2a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ta2a_ d.58.5.0 (A:) automated matches {Archaeoglobus fulgidus [TaxId: 224325]}
mkmvvavirpeklecvkkaleergfvgmtvtevkgrgeqkgirlqfrgrevevdllqktk
vevvvsddavdevveaivssartgkfgdgrifvipveksvkirtgdeev
Timeline for d3ta2a_: