SCOPe 2.06: Domain d3ta2a_: 3ta2 A:

Lineage for d3ta2a_ (3ta2 A:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.5: GlnB-like [54913] (6 families)
   form timeric structures with the orthogonally packed beta-sheets

5. Family d.58.5.0: automated matches [191474] (1 protein)
   not a true family

6. Protein automated matches [190753] (16 species)
   not a true protein

7. Species Archaeoglobus fulgidus [TaxId:224325] [189774] (4 PDB entries)

8. Domain d3ta2a_: 3ta2 A: [185735]
   automated match to d1qy7a_
   complexed with akg, atp, mg, ni

Details for d3ta2a_

PDB Entry: 3ta2, 1.9 Å

PDB Description: A. fulgidus GlnK3, MgATP/2-OG complex

PDB Compounds: (A:) Nitrogen regulatory protein P-II (GlnB-3)

SCOPe Domain Sequences for d3ta2a_:

Sequence; same for both SEQRES and ATOM records:

>d3ta2a_ d.58.5.0 (A:) automated matches {Archaeoglobus fulgidus [TaxId: 224325]}
mkmvvavirpeklecvkkaleergfvgmtvtevkgrgeqkgirlqfrgrevevdllqktk
vevvvsddavdevveaivssartgkfgdgrifvipveksvkirtgdeev

Timeline for d3ta2a_:

• d3ta2a_ first appeared in SCOPe 2.01
  
• d3ta2a_ appears in SCOPe 2.05
  
• d3ta2a_ appears in SCOPe 2.07
  
• d3ta2a_ appears in the current release, SCOPe 2.08