SCOPe 2.05: Domain d3ta1f_: 3ta1 F:

Lineage for d3ta1f_ (3ta1 F:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.5: GlnB-like [54913] (6 families)
   form timeric structures with the orthogonally packed beta-sheets

5. Family d.58.5.0: automated matches [191474] (1 protein)
   not a true family

6. Protein automated matches [190753] (14 species)
   not a true protein

7. Species Archaeoglobus fulgidus [TaxId:224325] [189774] (4 PDB entries)

8. Domain d3ta1f_: 3ta1 F: [185734]
   automated match to d1qy7a_
   complexed with adp

Details for d3ta1f_

PDB Entry: 3ta1, 1.9 Å

PDB Description: a. fulgidus glnk3, mgadp complex

PDB Compounds: (F:) Nitrogen regulatory protein P-II (GlnB-3)

SCOPe Domain Sequences for d3ta1f_:

Sequence; same for both SEQRES and ATOM records:

>d3ta1f_ d.58.5.0 (F:) automated matches {Archaeoglobus fulgidus [TaxId: 224325]}
mkmvvavirpeklecvkkaleergfvgmtvtevkgrgeqkgirlqfrgrevevdllqktk
vevvvsddavdevveaivssartgkfgdgrifvipveksvkirtgdeevaaa

Timeline for d3ta1f_:

• d3ta1f_ first appeared in SCOPe 2.01
  
• d3ta1f_ appears in SCOPe 2.04
  
• d3ta1f_ is called d3ta1f1 in SCOPe 2.06
  
• d3ta1f_ appears in the current release, SCOPe 2.08, called d3ta1f1