| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.5: GlnB-like [54913] (6 families) ![]() form timeric structures with the orthogonally packed beta-sheets |
| Family d.58.5.0: automated matches [191474] (1 protein) not a true family |
| Protein automated matches [190753] (4 species) not a true protein |
| Species Archaeoglobus fulgidus [TaxId:224325] [189774] (4 PDB entries) |
| Domain d3ta0d_: 3ta0 D: [185726] automated match to d1qy7a_ complexed with atp |
PDB Entry: 3ta0 (more details), 2.3 Å
SCOPe Domain Sequences for d3ta0d_:
Sequence, based on SEQRES records: (download)
>d3ta0d_ d.58.5.0 (D:) automated matches {Archaeoglobus fulgidus [TaxId: 224325]}
mkmvvavirpeklecvkkaleergfvgmtvtevkgrgeqkgirlqfrgrevevdllqktk
vevvvsddavdevveaivssartgkfgdgrifvipveksvkirtgdeevaaa
>d3ta0d_ d.58.5.0 (D:) automated matches {Archaeoglobus fulgidus [TaxId: 224325]}
mkmvvavirpeklecvkkaleergfvgmtvtevkgrgevdllqktkvevvvsddavdevv
eaivssartgkfgdgrifvipveksvkirtgdeevaaa
Timeline for d3ta0d_: