Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.5: GlnB-like [54913] (6 families) form timeric structures with the orthogonally packed beta-sheets |
Family d.58.5.0: automated matches [191474] (1 protein) not a true family |
Protein automated matches [190753] (16 species) not a true protein |
Species Archaeoglobus fulgidus [TaxId:224325] [189774] (4 PDB entries) |
Domain d3ta0c1: 3ta0 C:1-109 [185725] Other proteins in same PDB: d3ta0a2, d3ta0b2, d3ta0c2, d3ta0d2, d3ta0e2, d3ta0f2 automated match to d1qy7a_ complexed with atp |
PDB Entry: 3ta0 (more details), 2.3 Å
SCOPe Domain Sequences for d3ta0c1:
Sequence, based on SEQRES records: (download)
>d3ta0c1 d.58.5.0 (C:1-109) automated matches {Archaeoglobus fulgidus [TaxId: 224325]} mkmvvavirpeklecvkkaleergfvgmtvtevkgrgeqkgirlqfrgrevevdllqktk vevvvsddavdevveaivssartgkfgdgrifvipveksvkirtgdeev
>d3ta0c1 d.58.5.0 (C:1-109) automated matches {Archaeoglobus fulgidus [TaxId: 224325]} mkmvvavirpeklecvkkaleergfvgmtvtevkgrgevdllqktkvevvvsddavdevv eaivssartgkfgdgrifvipveksvkirtgdeev
Timeline for d3ta0c1: