SCOPe 2.06: Domain d3ta0c1: 3ta0 C:1-109

Lineage for d3ta0c1 (3ta0 C:1-109)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.5: GlnB-like [54913] (6 families)
   form timeric structures with the orthogonally packed beta-sheets

5. Family d.58.5.0: automated matches [191474] (1 protein)
   not a true family

6. Protein automated matches [190753] (16 species)
   not a true protein

7. Species Archaeoglobus fulgidus [TaxId:224325] [189774] (4 PDB entries)

8. Domain d3ta0c1: 3ta0 C:1-109 [185725]
   Other proteins in same PDB: d3ta0a2, d3ta0b2, d3ta0c2, d3ta0d2, d3ta0e2, d3ta0f2
   automated match to d1qy7a_
   complexed with atp

Details for d3ta0c1

PDB Entry: 3ta0, 2.3 Å

PDB Description: A. fulgidus GlnK3, MgATP complex

PDB Compounds: (C:) Nitrogen regulatory protein P-II (GlnB-3)

SCOPe Domain Sequences for d3ta0c1:

Sequence, based on SEQRES records:

>d3ta0c1 d.58.5.0 (C:1-109) automated matches {Archaeoglobus fulgidus [TaxId: 224325]}
mkmvvavirpeklecvkkaleergfvgmtvtevkgrgeqkgirlqfrgrevevdllqktk
vevvvsddavdevveaivssartgkfgdgrifvipveksvkirtgdeev

Sequence, based on observed residues (ATOM records):

>d3ta0c1 d.58.5.0 (C:1-109) automated matches {Archaeoglobus fulgidus [TaxId: 224325]}
mkmvvavirpeklecvkkaleergfvgmtvtevkgrgevdllqktkvevvvsddavdevv
eaivssartgkfgdgrifvipveksvkirtgdeev

Timeline for d3ta0c1:

• d3ta0c1 first appeared in SCOPe 2.01, called d3ta0c_
  
• d3ta0c1 was called d3ta0c_ in SCOPe 2.05
  
• d3ta0c1 appears in SCOPe 2.07
  
• d3ta0c1 appears in the current release, SCOPe 2.08