Lineage for d3ta0b1 (3ta0 B:1-109)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2555938Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2557428Superfamily d.58.5: GlnB-like [54913] (6 families) (S)
    form timeric structures with the orthogonally packed beta-sheets
  5. 2557730Family d.58.5.0: automated matches [191474] (1 protein)
    not a true family
  6. 2557731Protein automated matches [190753] (21 species)
    not a true protein
  7. 2557751Species Archaeoglobus fulgidus [TaxId:224325] [189774] (4 PDB entries)
  8. 2557768Domain d3ta0b1: 3ta0 B:1-109 [185724]
    Other proteins in same PDB: d3ta0a2, d3ta0b2, d3ta0c2, d3ta0d2, d3ta0e2, d3ta0f2
    automated match to d1qy7a_
    complexed with atp

Details for d3ta0b1

PDB Entry: 3ta0 (more details), 2.3 Å

PDB Description: A. fulgidus GlnK3, MgATP complex
PDB Compounds: (B:) Nitrogen regulatory protein P-II (GlnB-3)

SCOPe Domain Sequences for d3ta0b1:

Sequence, based on SEQRES records: (download)

>d3ta0b1 d.58.5.0 (B:1-109) automated matches {Archaeoglobus fulgidus [TaxId: 224325]}
mkmvvavirpeklecvkkaleergfvgmtvtevkgrgeqkgirlqfrgrevevdllqktk
vevvvsddavdevveaivssartgkfgdgrifvipveksvkirtgdeev

Sequence, based on observed residues (ATOM records): (download)

>d3ta0b1 d.58.5.0 (B:1-109) automated matches {Archaeoglobus fulgidus [TaxId: 224325]}
mkmvvavirpeklecvkkaleergfvgmtvtevkgrgedllqktkvevvvsddavdevve
aivssartgkfgdgrifvipveksvkirtgdeev

SCOPe Domain Coordinates for d3ta0b1:

Click to download the PDB-style file with coordinates for d3ta0b1.
(The format of our PDB-style files is described here.)

Timeline for d3ta0b1: