SCOPe 2.05: Domain d3t9zf_: 3t9z F:

Lineage for d3t9zf_ (3t9z F:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.5: GlnB-like [54913] (6 families)
   form timeric structures with the orthogonally packed beta-sheets

5. Family d.58.5.0: automated matches [191474] (1 protein)
   not a true family

6. Protein automated matches [190753] (14 species)
   not a true protein

7. Species Archaeoglobus fulgidus [TaxId:224325] [189774] (4 PDB entries)

8. Domain d3t9zf_: 3t9z F: [185722]
   automated match to d1qy7a_
   complexed with flc

Details for d3t9zf_

PDB Entry: 3t9z, 1.82 Å

PDB Description: a. fulgidus glnk3, ligand-free

PDB Compounds: (F:) Nitrogen regulatory protein P-II (GlnB-3)

SCOPe Domain Sequences for d3t9zf_:

Sequence, based on SEQRES records:

>d3t9zf_ d.58.5.0 (F:) automated matches {Archaeoglobus fulgidus [TaxId: 224325]}
mkmvvavirpeklecvkkaleergfvgmtvtevkgrgeqkgirlqfrgrevevdllqktk
vevvvsddavdevveaivssartgkfgdgrifvipveksvkirtgdeevaa

Sequence, based on observed residues (ATOM records):

>d3t9zf_ d.58.5.0 (F:) automated matches {Archaeoglobus fulgidus [TaxId: 224325]}
mkmvvavirpeklecvkkaleergfvgmtvtevkgrgllqktkvevvvsddavdevveai
vssartgkfgdgrifvipveksvkirtgdeevaa

Timeline for d3t9zf_:

• d3t9zf_ first appeared in SCOPe 2.01
  
• d3t9zf_ appears in SCOPe 2.04
  
• d3t9zf_ is called d3t9zf1 in SCOPe 2.06
  
• d3t9zf_ appears in the current release, SCOPe 2.08, called d3t9zf1