Details for d1bxre1

PDB Entry: 1bxr (more details), 2.1 Å

PDB Description: structure of carbamoyl phosphate synthetase complexed with the atp analog amppnp

SCOP Domain Sequences for d1bxre1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bxre1 a.92.1.1 (E:403-555) Carbamoyl phosphate synthetase, large subunit connection domain {Escherichia coli}
evgatgfdpkvslddpealtkirrelkdagadriwyiadafraglsvdgvfnltnidrwf
lvqieelvrleekvaevgitglnadflrqlkrkgfadarlaklagvreaeirklrdqydl
hpvykrvdtcaaefatdtaymystyeeeceanp

SCOP Domain Coordinates for d1bxre1:

Click to download the PDB-style file with coordinates for d1bxre1.
(The format of our PDB-style files is described here.)

Timeline for d1bxre1: