| Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
| Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.5: GlnB-like [54913] (6 families) ![]() form timeric structures with the orthogonally packed beta-sheets |
| Family d.58.5.0: automated matches [191474] (1 protein) not a true family |
| Protein automated matches [190753] (21 species) not a true protein |
| Species Archaeoglobus fulgidus [TaxId:224325] [189774] (4 PDB entries) |
| Domain d3t9za1: 3t9z A:1-109 [185717] Other proteins in same PDB: d3t9za2, d3t9zb2, d3t9zc2, d3t9zd2, d3t9ze2, d3t9zf2 automated match to d1qy7a_ complexed with flc |
PDB Entry: 3t9z (more details), 1.82 Å
SCOPe Domain Sequences for d3t9za1:
Sequence, based on SEQRES records: (download)
>d3t9za1 d.58.5.0 (A:1-109) automated matches {Archaeoglobus fulgidus [TaxId: 224325]}
mkmvvavirpeklecvkkaleergfvgmtvtevkgrgeqkgirlqfrgrevevdllqktk
vevvvsddavdevveaivssartgkfgdgrifvipveksvkirtgdeev
>d3t9za1 d.58.5.0 (A:1-109) automated matches {Archaeoglobus fulgidus [TaxId: 224325]}
mkmvvavirpeklecvkkaleergfvgmtvtevkgrgllqktkvevvvsddavdevveai
vssartgkfgdgrifvipveksvkirtgdeev
Timeline for d3t9za1: