Lineage for d3t9xd_ (3t9x D:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2520986Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2520987Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2520988Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins)
  6. 2521242Protein Glutamate receptor ligand binding core [53881] (5 species)
  7. 2521254Species Norway rat (Rattus norvegicus), GluR2 [TaxId:10116] [53882] (157 PDB entries)
  8. 2521396Domain d3t9xd_: 3t9x D: [185715]
    automated match to d1mm6a_
    complexed with glu, zn; mutant

Details for d3t9xd_

PDB Entry: 3t9x (more details), 1.82 Å

PDB Description: glutamate bound to a double cysteine mutant (v484c/e657c) of the ligand binding domain of glua2
PDB Compounds: (D:) Glutamate receptor 2

SCOPe Domain Sequences for d3t9xd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3t9xd_ c.94.1.1 (D:) Glutamate receptor ligand binding core {Norway rat (Rattus norvegicus), GluR2 [TaxId: 10116]}
ktvvvttilespyvmmkknhemlegneryegycvdlaaeiakhcgfkykltivgdgkyga
rdadtkiwngmvgelvygkadiaiapltitlcreevidfskpfmslgisimikkgtpies
aedlskqteiaygtldsgstkcffrrskiavfdkmwtymrsaepsvfvrttaegvarvrk
skgkyayllestmneyieqrkpcdtmkvggnldskgygiatpkgsslgnavnlavlklne
qglldklknkwwydkgec

SCOPe Domain Coordinates for d3t9xd_:

Click to download the PDB-style file with coordinates for d3t9xd_.
(The format of our PDB-style files is described here.)

Timeline for d3t9xd_: