Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) Similar in architecture to the superfamily I but partly differs in topology |
Family c.94.1.1: Phosphate binding protein-like [53851] (41 proteins) |
Protein Glutamate receptor ligand binding core [53881] (5 species) |
Species Rat (Rattus norvegicus), GluR2 [TaxId:10116] [53882] (101 PDB entries) |
Domain d3t9xd_: 3t9x D: [185715] automated match to d1mm6a_ complexed with glu, zn; mutant |
PDB Entry: 3t9x (more details), 1.82 Å
SCOPe Domain Sequences for d3t9xd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3t9xd_ c.94.1.1 (D:) Glutamate receptor ligand binding core {Rat (Rattus norvegicus), GluR2 [TaxId: 10116]} ktvvvttilespyvmmkknhemlegneryegycvdlaaeiakhcgfkykltivgdgkyga rdadtkiwngmvgelvygkadiaiapltitlcreevidfskpfmslgisimikkgtpies aedlskqteiaygtldsgstkcffrrskiavfdkmwtymrsaepsvfvrttaegvarvrk skgkyayllestmneyieqrkpcdtmkvggnldskgygiatpkgsslgnavnlavlklne qglldklknkwwydkgec
Timeline for d3t9xd_: