Lineage for d3t9ta_ (3t9t A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2979545Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2979546Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2979693Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2983087Protein Tyrosine-protein kinase Itk/Tsk [111194] (1 species)
    PTK group; Tec/Atk subfamily; non-membrane spanning protein tyrosine kinase
  7. 2983088Species Human (Homo sapiens) [TaxId:9606] [111195] (33 PDB entries)
    Uniprot Q08881 357-619
  8. 2983092Domain d3t9ta_: 3t9t A: [185708]
    automated match to d1sm2a_
    complexed with gol, iaq; mutant

Details for d3t9ta_

PDB Entry: 3t9t (more details), 1.65 Å

PDB Description: Crystal structure of BTK mutant (F435T,K596R) complexed with Imidazo[1,5-a]quinoxaline
PDB Compounds: (A:) Tyrosine-protein kinase ITK/TSK

SCOPe Domain Sequences for d3t9ta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3t9ta_ d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]}
wvidpseltfvqeigsgqfglvhlgywlnkdkvaiktiregamseedfieeaevmmklsh
pklvqlygvcleqapiclvtefmehgclsdylrtqrglfaaetllgmcldvcegmaylee
acvihrdlaarnclvgenqvikvsdfgmtrfvlddqytsstgtkfpvkwaspevfsfsry
ssksdvwsfgvlmwevfsegkipyenrsnsevvedistgfrlykprlasthvyqimnhcw
rerpedrpafsrllrqlaeiaes

SCOPe Domain Coordinates for d3t9ta_:

Click to download the PDB-style file with coordinates for d3t9ta_.
(The format of our PDB-style files is described here.)

Timeline for d3t9ta_: