Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
Superfamily d.17.4: NTF2-like [54427] (31 families) has a beta-alpha(2)-beta insertion after the main helix |
Family d.17.4.3: Ketosteroid isomerase-like [54434] (2 proteins) |
Protein Delta-5-3-ketosteroid isomerase, steroid delta-isomerase, KSI [54435] (2 species) |
Species Pseudomonas putida [TaxId:303] [54437] (35 PDB entries) Uniprot P07445 |
Domain d3t8nd_: 3t8n D: [185691] automated match to d1e3vb_ complexed with edt, so4 |
PDB Entry: 3t8n (more details), 1.47 Å
SCOPe Domain Sequences for d3t8nd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3t8nd_ d.17.4.3 (D:) Delta-5-3-ketosteroid isomerase, steroid delta-isomerase, KSI {Pseudomonas putida [TaxId: 303]} mnlptaqevqglmaraielvdvgdieaivqmyaddatvedpfgqppihgreqiaafyrqg lgggkvracltgpvrashngcgampfrvemvwngqpcaldviavmrfdehgriqtmqayw sevnlsv
Timeline for d3t8nd_: