![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
![]() | Superfamily d.79.5: IpsF-like [69765] (2 families) ![]() forms trimers with three closely packed beta-sheets; possible link between the YjgF-like (d.79.1) and 4'-phosphopantetheinyl transferase superfamilies (d.150.1) |
![]() | Family d.79.5.1: IpsF-like [69766] (3 proteins) automatically mapped to Pfam PF02542 |
![]() | Protein automated matches [190985] (6 species) not a true protein |
![]() | Species Salmonella typhimurium [TaxId:90371] [189751] (2 PDB entries) |
![]() | Domain d3t80b1: 3t80 B:1-156 [185680] Other proteins in same PDB: d3t80a2, d3t80b2, d3t80c2, d3t80d2, d3t80e2, d3t80f2 automated match to d1h48c_ complexed with ctn, edo, mg, pop, zn |
PDB Entry: 3t80 (more details), 2.5 Å
SCOPe Domain Sequences for d3t80b1:
Sequence, based on SEQRES records: (download)
>d3t80b1 d.79.5.1 (B:1-156) automated matches {Salmonella typhimurium [TaxId: 90371]} mrighgfdvhafggegpiiiggvripyekgllahsdgdvalhaltdallgaaalgdigkl fpdtdpafkgadsrellreawrriqakgytlgnvdvtiiaqapkmlphipqmrvfiaedl gchmdevnvkattteklgftgrgegiaceavallmk
>d3t80b1 d.79.5.1 (B:1-156) automated matches {Salmonella typhimurium [TaxId: 90371]} mrighgfdvhafggegpiiiggvripyekgllahsdgdvalhaltdallgaaalgdigkl adsrellreawrriqakgytlgnvdvtiiaqapkmlphipqmrvfiaedlgchmdevnvk attteklgftgrgegiaceavallmk
Timeline for d3t80b1: