SCOPe 2.06: Domain d3t7mb1: 3t7m B:1-262

Lineage for d3t7mb1 (3t7m B:1-262)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest

4. Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families)

5. Family c.68.1.14: Glycogenin [75273] (2 proteins)

6. Protein Glycogenin [75274] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [189634] (14 PDB entries)

8. Domain d3t7mb1: 3t7m B:1-262 [185672]
   Other proteins in same PDB: d3t7ma2, d3t7mb2
   automated match to d1ll0a_
   complexed with edo, mn, udp

Details for d3t7mb1

PDB Entry: 3t7m, 1.8 Å

PDB Description: Crystal Structure of Human Glycogenin-1 (GYG1) complexed with manganese and UDP, in a triclinic closed form

PDB Compounds: (B:) glycogenin-1

SCOPe Domain Sequences for d3t7mb1:

Sequence; same for both SEQRES and ATOM records:

>d3t7mb1 c.68.1.14 (B:1-262) Glycogenin {Human (Homo sapiens) [TaxId: 9606]}
mtdqafvtlttndayakgalvlgsslkqhrttrrlvvlatpqvsdsmrkvletvfdevim
vdvldsgdsahltlmkrpelgvtltklhcwsltqyskcvfmdadtlvlaniddlfdreel
saapdpgwpdcfnsgvfvyqpsvetynqllhlaseqgsfdggdqgilntffsswattdir
khlpfiynlssisiysylpafkvfgasakvvhflgrvkpwnytydpktksvkseahdpnm
thpeflilwwnifttnvlpllq

Timeline for d3t7mb1:

• d3t7mb1 first appeared in SCOPe 2.01, called d3t7mb_
  
• d3t7mb1 was called d3t7mb_ in SCOPe 2.05
  
• d3t7mb1 appears in SCOPe 2.07
  
• d3t7mb1 appears in the current release, SCOPe 2.08