Lineage for d3t7ma_ (3t7m A:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1001844Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest
  4. 1001845Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) (S)
  5. 1002361Family c.68.1.14: Glycogenin [75273] (1 protein)
  6. 1002362Protein Glycogenin [75274] (2 species)
  7. 1002363Species Human (Homo sapiens) [TaxId:9606] [189634] (11 PDB entries)
  8. 1002371Domain d3t7ma_: 3t7m A: [185671]
    automated match to d1ll0a_
    complexed with edo, mn, udp

Details for d3t7ma_

PDB Entry: 3t7m (more details), 1.8 Å

PDB Description: Crystal Structure of Human Glycogenin-1 (GYG1) complexed with manganese and UDP, in a triclinic closed form
PDB Compounds: (A:) glycogenin-1

SCOPe Domain Sequences for d3t7ma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3t7ma_ c.68.1.14 (A:) Glycogenin {Human (Homo sapiens) [TaxId: 9606]}
smtdqafvtlttndayakgalvlgsslkqhrttrrlvvlatpqvsdsmrkvletvfdevi
mvdvldsgdsahltlmkrpelgvtltklhcwsltqyskcvfmdadtlvlaniddlfdree
lsaapdpgwpdcfnsgvfvyqpsvetynqllhlaseqgsfdggdqgilntffsswattdi
rkhlpfiynlssisiysylpafkvfgasakvvhflgrvkpwnytydpktksvkseahdpn
mthpeflilwwnifttnvlpllq

SCOPe Domain Coordinates for d3t7ma_:

Click to download the PDB-style file with coordinates for d3t7ma_.
(The format of our PDB-style files is described here.)

Timeline for d3t7ma_: