Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.1: CheY-like [52172] (8 families) |
Family c.23.1.0: automated matches [191324] (1 protein) not a true family |
Protein automated matches [190131] (16 species) not a true protein |
Species Chloroflexus aurantiacus [TaxId:324602] [189714] (1 PDB entry) |
Domain d3t6ka_: 3t6k A: [185664] automated match to d1mvoa_ complexed with edo, so4 |
PDB Entry: 3t6k (more details), 1.86 Å
SCOPe Domain Sequences for d3t6ka_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3t6ka_ c.23.1.0 (A:) automated matches {Chloroflexus aurantiacus [TaxId: 324602]} kphtllivddddtvaemlelvlrgagyevrraasgeealqqiyknlpdalicdvllpgid gytlckrvrqhpltktlpilmltaqgdisakiagfeagandylakpfepqelvyrvknil ar
Timeline for d3t6ka_: