SCOPe 2.02: Domain d3t6fb_: 3t6f B:

Lineage for d3t6fb_ (3t6f B:)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.61: Streptavidin-like [50875] (8 superfamilies)
   barrel, closed; n=8, S=10; meander

4. Superfamily b.61.1: Avidin/streptavidin [50876] (2 families)

5. Family b.61.1.1: Avidin/streptavidin [50877] (3 proteins)

6. Protein automated matches [190191] (2 species)
   not a true protein

7. Species Streptomyces avidinii [TaxId:1895] [189343] (8 PDB entries)

8. Domain d3t6fb_: 3t6f B: [185663]
   automated match to d1n9mc_
   complexed with bso, btn, gol, so4

Details for d3t6fb_

PDB Entry: 3t6f, 1.22 Å

PDB Description: biotin complex of y54f core streptavidin

PDB Compounds: (B:) streptavidin

SCOPe Domain Sequences for d3t6fb_:

Sequence; same for both SEQRES and ATOM records:

>d3t6fb_ b.61.1.1 (B:) automated matches {Streptomyces avidinii [TaxId: 1895]}
agitgtwynqlgstfivtagadgaltgtyesavgnaesrfvltgrydsapatdgsgtalg
wtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftkvk
ps

Timeline for d3t6fb_:

• d3t6fb_ first appeared in SCOPe 2.01
  
• d3t6fb_ appears in SCOPe 2.03
  
• d3t6fb_ appears in the current release, SCOPe 2.08