Lineage for d3t6el_ (3t6e L:)

  1. Root: SCOPe 2.03
  2. 1454900Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1457799Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
    five transmembrane helices forming a sheet-like structure
  4. 1457800Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family) (S)
    automatically mapped to Pfam PF00124
  5. 1457801Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins)
    L and M are probably related to each other
  6. 1457967Protein automated matches [190224] (5 species)
    not a true protein
  7. 1457968Species Blastochloris viridis [TaxId:1079] [187141] (5 PDB entries)
  8. 1457969Domain d3t6el_: 3t6e L: [185660]
    Other proteins in same PDB: d3t6ec_, d3t6eh1, d3t6eh2
    automated match to d1prcl_
    complexed with bcb, bpb, dga, fe2, gol, hec, hto, lda, mq9, ns5, so4, uq9

Details for d3t6el_

PDB Entry: 3t6e (more details), 1.92 Å

PDB Description: Crystal Structure of the Reaction Centre from Blastochloris viridis strain DSM 133 (ATCC 19567) substrain-94
PDB Compounds: (L:) reaction center protein l chain

SCOPe Domain Sequences for d3t6el_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3t6el_ f.26.1.1 (L:) automated matches {Blastochloris viridis [TaxId: 1079]}
allsferkyrvrggtliggdlfdfwvgpyfvgffgvsaiffiflgvsligyaasqgptwd
pfaisinppdlkyglgaaplleggfwqaitvcalgafiswmlreveisrklgigwhvpla
fcvpifmfcvlqvfrplllgswghafpygilshldwvnnfgyqylnwhynpghmssvsfl
fvnamalglhgglilsvanpgdgdkvktaehenqyfrdvvgysigalsihrlglflasni
fltgafgtiasgpfwtrgwpewwgwwldipfws

SCOPe Domain Coordinates for d3t6el_:

Click to download the PDB-style file with coordinates for d3t6el_.
(The format of our PDB-style files is described here.)

Timeline for d3t6el_: