Details for d1ce8a1

PDB Entry: 1ce8 (more details), 2.1 Å

PDB Description: carbamoyl phosphate synthetase from escherichis coli with complexed with the allosteric ligand imp

SCOP Domain Sequences for d1ce8a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ce8a1 a.92.1.1 (A:403-555) Carbamoyl phosphate synthetase, large subunit connection domain {Escherichia coli}
evgatgfdpkvslddpealtkirrelkdagadriwyiadafraglsvdgvfnltnidrwf
lvqieelvrleekvaevgitglnadflrqlkrkgfadarlaklagvreaeirklrdqydl
hpvykrvdtcaaefatdtaymystyeeeceanp

SCOP Domain Coordinates for d1ce8a1:

Click to download the PDB-style file with coordinates for d1ce8a1.
(The format of our PDB-style files is described here.)

Timeline for d1ce8a1: