SCOPe 2.06: Domain d3t65a1: 3t65 A:1-107

Lineage for d3t65a1 (3t65 A:1-107)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 1.2 [TaxId:10090] [88525] (51 PDB entries)

8. Domain d3t65a1: 3t65 A:1-107 [185654]
   Other proteins in same PDB: d3t65a2, d3t65b1, d3t65b2
   part of Fab s25-2
   complexed with mg, zn

Details for d3t65a1

PDB Entry: 3t65, 1.45 Å

PDB Description: s25-2- a(2-8)kdo disaccharide complex

PDB Compounds: (A:) S25-2 Fab (IgG1k) light chain

SCOPe Domain Sequences for d3t65a1:

Sequence; same for both SEQRES and ATOM records:

>d3t65a1 b.1.1.1 (A:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.2 [TaxId: 10090]}
divmsqspsslavsagekvtmsckssqsllnsrtrknylawyqqkpgqspklliywastr
esgvpdrftgsgsgtdftltitsvqaedlavyyckqsynlrtfgggtkleikr

Timeline for d3t65a1:

• d3t65a1 first appeared in SCOPe 2.01
  
• d3t65a1 appears in SCOPe 2.05
  
• d3t65a1 appears in SCOPe 2.07
  
• d3t65a1 appears in the current release, SCOPe 2.08