Lineage for d3t5id_ (3t5i D:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2765063Superfamily b.1.18: E set domains [81296] (27 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2765599Family b.1.18.8: RhoGDI-like [81288] (3 proteins)
  6. 2765600Protein GMP-PDE delta [74846] (1 species)
  7. 2765601Species Human (Homo sapiens) [TaxId:9606] [74847] (25 PDB entries)
  8. 2765621Domain d3t5id_: 3t5i D: [185653]
    automated match to d1kshb_
    complexed with far

Details for d3t5id_

PDB Entry: 3t5i (more details), 2.1 Å

PDB Description: structure of fully modified farnesylated rheb peptide in complex with pde6d
PDB Compounds: (D:) Retinal rod rhodopsin-sensitive cGMP 3',5'-cyclic phosphodiesterase subunit delta

SCOPe Domain Sequences for d3t5id_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3t5id_ b.1.18.8 (D:) GMP-PDE delta {Human (Homo sapiens) [TaxId: 9606]}
sakderareilrgfklnwmnlrdaetgkilwqgtedlsvpgvehearvpkkilkckavsr
elnfssteqmekfrleqkvyfkgqcleewffefgfvipnstntwqslieaapesqmmpas
vltgnviietkffdddllvstsrvrlfyv

SCOPe Domain Coordinates for d3t5id_:

Click to download the PDB-style file with coordinates for d3t5id_.
(The format of our PDB-style files is described here.)

Timeline for d3t5id_: