Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (24 families) "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
Family b.1.18.8: RhoGDI-like [81288] (3 proteins) |
Protein GMP-PDE delta [74846] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [74847] (5 PDB entries) |
Domain d3t5ic_: 3t5i C: [185652] automated match to d1kshb_ complexed with far |
PDB Entry: 3t5i (more details), 2.1 Å
SCOPe Domain Sequences for d3t5ic_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3t5ic_ b.1.18.8 (C:) GMP-PDE delta {Human (Homo sapiens) [TaxId: 9606]} sakderareilrgfklnwmnlrdaetgkilwqgtedlsvpgvehearvpkkilkckavsr elnfssteqmekfrleqkvyfkgqcleewffefgfvipnstntwqslieaapesqmmpas vltgnviietkffdddllvstsrvrlfyv
Timeline for d3t5ic_: