| Class a: All alpha proteins [46456] (286 folds) |
| Fold a.92: Carbamoyl phosphate synthetase, large subunit connection domain [48107] (1 superfamily) multihelical; consists of two all-alpha subdomains possible duplication: subdomains have similar topologies |
Superfamily a.92.1: Carbamoyl phosphate synthetase, large subunit connection domain [48108] (1 family) ![]() automatically mapped to Pfam PF02787 |
| Family a.92.1.1: Carbamoyl phosphate synthetase, large subunit connection domain [48109] (1 protein) |
| Protein Carbamoyl phosphate synthetase, large subunit connection domain [48110] (1 species) |
| Species Escherichia coli [TaxId:562] [48111] (10 PDB entries) Uniprot P00968 |
| Domain d1c3og1: 1c3o G:403-555 [18565] Other proteins in same PDB: d1c3oa2, d1c3oa3, d1c3oa4, d1c3oa5, d1c3oa6, d1c3ob1, d1c3ob2, d1c3oc2, d1c3oc3, d1c3oc4, d1c3oc5, d1c3oc6, d1c3od1, d1c3od2, d1c3oe2, d1c3oe3, d1c3oe4, d1c3oe5, d1c3oe6, d1c3of1, d1c3of2, d1c3og2, d1c3og3, d1c3og4, d1c3og5, d1c3og6, d1c3oh1, d1c3oh2 complexed with adp, cl, gln, k, mn, net, orn, po4; mutant |
PDB Entry: 1c3o (more details), 2.1 Å
SCOPe Domain Sequences for d1c3og1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1c3og1 a.92.1.1 (G:403-555) Carbamoyl phosphate synthetase, large subunit connection domain {Escherichia coli [TaxId: 562]}
evgatgfdpkvslddpealtkirrelkdagadriwyiadafraglsvdgvfnltnidrwf
lvqieelvrleekvaevgitglnadflrqlkrkgfadarlaklagvreaeirklrdqydl
hpvykrvdtcaaefatdtaymystyeeeceanp
Timeline for d1c3og1:
View in 3DDomains from other chains: (mouse over for more information) d1c3oa1, d1c3oa2, d1c3oa3, d1c3oa4, d1c3oa5, d1c3oa6, d1c3ob1, d1c3ob2, d1c3oc1, d1c3oc2, d1c3oc3, d1c3oc4, d1c3oc5, d1c3oc6, d1c3od1, d1c3od2, d1c3oe1, d1c3oe2, d1c3oe3, d1c3oe4, d1c3oe5, d1c3oe6, d1c3of1, d1c3of2, d1c3oh1, d1c3oh2 |