Details for d1c3og1

PDB Entry: 1c3o (more details), 2.1 Å

PDB Description: crystal structure of the carbamoyl phosphate synthetase: small subunit mutant c269s with bound glutamine

SCOP Domain Sequences for d1c3og1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c3og1 a.92.1.1 (G:403-555) Carbamoyl phosphate synthetase, large subunit connection domain {Escherichia coli}
evgatgfdpkvslddpealtkirrelkdagadriwyiadafraglsvdgvfnltnidrwf
lvqieelvrleekvaevgitglnadflrqlkrkgfadarlaklagvreaeirklrdqydl
hpvykrvdtcaaefatdtaymystyeeeceanp

SCOP Domain Coordinates for d1c3og1:

Click to download the PDB-style file with coordinates for d1c3og1.
(The format of our PDB-style files is described here.)

Timeline for d1c3og1: