SCOPe 2.08: Domain d3t5ga_: 3t5g A:

Lineage for d3t5ga_ (3t5g A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (81 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein GTP-binding protein RheB [142275] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [142276] (9 PDB entries)
   Uniprot Q15382 3-169

8. Domain d3t5ga_: 3t5g A: [185648]
   Other proteins in same PDB: d3t5gb_
   automated match to d1xtqa1
   complexed with far, gdp, mg

Details for d3t5ga_

PDB Entry: 3t5g, 1.7 Å

PDB Description: structure of fully modified farnesylated rheb in complex with pde6d

PDB Compounds: (A:) GTP-binding protein Rheb

SCOPe Domain Sequences for d3t5ga_:

Sequence, based on SEQRES records:

>d3t5ga_ c.37.1.8 (A:) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]}
pqsksrkiailgyrsvgkssltiqfvegqfvdsydptientftklitvngqeyhlqlvdt
agqdeysifpqtysidingyilvysvtsiksfevikvihgklldmvgkvqipimlvgnkk
dlhmervisyeegkalaeswnaaflessakenqtavdvfrriileaekmdgacsqgkssc

Sequence, based on observed residues (ATOM records):

>d3t5ga_ c.37.1.8 (A:) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]}
pqsksrkiailgyrsvgkssltiqfvegqfvdsydptientftklitvngqeyhlqlvdt
agqdeysifpqtysidingyilvysvtsiksfevikvihgklldmvipimlvgnkkdlhm
ervisyeegkalaeswnaaflessakenqtavdvfrriileaekmqgkssc

Timeline for d3t5ga_:

• d3t5ga_ first appeared in SCOPe 2.01
  
• d3t5ga_ appears in SCOPe 2.07