![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.82: N domain of copper amine oxidase-like [55382] (5 superfamilies) alpha-beta(5)-alpha; 2 layers: alpha/beta; meander antiparallel sheet |
![]() | Superfamily d.82.2: Frataxin/Nqo15-like [55387] (3 families) ![]() |
![]() | Family d.82.2.1: Frataxin-like [55388] (3 proteins) iron homeostasis proteins automatically mapped to Pfam PF01491 |
![]() | Protein automated matches [191244] (1 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [189711] (10 PDB entries) |
![]() | Domain d3t3xa_: 3t3x A: [185641] automated match to d1ly7a_ complexed with so4 |
PDB Entry: 3t3x (more details), 1.57 Å
SCOPe Domain Sequences for d3t3xa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3t3xa_ d.82.2.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} sldettyerlaeetldslaeffedladkpytfedydvsfgsgvltvklggdlgtyvinkq tpnkqiwlsspssgpkcydwtgknwvyshdgvslhellaaeltkalktkldlsslaysgk da
Timeline for d3t3xa_: