Lineage for d1c3oe1 (1c3o E:403-555)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 445866Fold a.92: Carbamoyl phosphate synthetase, large subunit connection domain [48107] (1 superfamily)
    multihelical; consists of two all-alpha subdomains
    possible duplication: subdomains have similar topologies
  4. 445867Superfamily a.92.1: Carbamoyl phosphate synthetase, large subunit connection domain [48108] (1 family) (S)
  5. 445868Family a.92.1.1: Carbamoyl phosphate synthetase, large subunit connection domain [48109] (1 protein)
  6. 445869Protein Carbamoyl phosphate synthetase, large subunit connection domain [48110] (1 species)
  7. 445870Species Escherichia coli [TaxId:562] [48111] (10 PDB entries)
  8. 445893Domain d1c3oe1: 1c3o E:403-555 [18564]
    Other proteins in same PDB: d1c3oa2, d1c3oa3, d1c3oa4, d1c3oa5, d1c3oa6, d1c3ob1, d1c3ob2, d1c3oc2, d1c3oc3, d1c3oc4, d1c3oc5, d1c3oc6, d1c3od1, d1c3od2, d1c3oe2, d1c3oe3, d1c3oe4, d1c3oe5, d1c3oe6, d1c3of1, d1c3of2, d1c3og2, d1c3og3, d1c3og4, d1c3og5, d1c3og6, d1c3oh1, d1c3oh2

Details for d1c3oe1

PDB Entry: 1c3o (more details), 2.1 Å

PDB Description: crystal structure of the carbamoyl phosphate synthetase: small subunit mutant c269s with bound glutamine

SCOP Domain Sequences for d1c3oe1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c3oe1 a.92.1.1 (E:403-555) Carbamoyl phosphate synthetase, large subunit connection domain {Escherichia coli}
evgatgfdpkvslddpealtkirrelkdagadriwyiadafraglsvdgvfnltnidrwf
lvqieelvrleekvaevgitglnadflrqlkrkgfadarlaklagvreaeirklrdqydl
hpvykrvdtcaaefatdtaymystyeeeceanp

SCOP Domain Coordinates for d1c3oe1:

Click to download the PDB-style file with coordinates for d1c3oe1.
(The format of our PDB-style files is described here.)

Timeline for d1c3oe1: