Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.169: C-type lectin-like [56435] (1 superfamily) unusual fold |
Superfamily d.169.1: C-type lectin-like [56436] (9 families) |
Family d.169.1.0: automated matches [191331] (1 protein) not a true family |
Protein automated matches [190159] (8 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [187331] (13 PDB entries) |
Domain d3t3aa_: 3t3a A: [185632] automated match to d1ypoa1 complexed with po4; mutant |
PDB Entry: 3t3a (more details), 2.3 Å
SCOPe Domain Sequences for d3t3aa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3t3aa_ d.169.1.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} ecpqdwlshrdkcfrvsqvsntweeglvdcdgkgatlmliqdqeelrflldsikekynsf wiglrytlpdmnwkwingstlnsdvlkitgdtendscaaisgdkvtfescnsdnrwicqk el
Timeline for d3t3aa_: