Lineage for d3t30c_ (3t30 C:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1812227Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
    sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
    characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies
  4. 1812356Superfamily b.121.3: Nucleoplasmin-like core domain [69203] (2 families) (S)
    oligomerizes into a pentameric ring structure
  5. 1812423Family b.121.3.0: automated matches [191665] (1 protein)
    not a true family
  6. 1812424Protein automated matches [191264] (1 species)
    not a true protein
  7. 1812425Species Human (Homo sapiens) [TaxId:9606] [189827] (1 PDB entry)
  8. 1812428Domain d3t30c_: 3t30 C: [185624]
    automated match to d1k5ja_

Details for d3t30c_

PDB Entry: 3t30 (more details), 1.9 Å

PDB Description: human nucleoplasmin (npm2): a histone chaperone in oocytes and early embryos
PDB Compounds: (C:) Nucleoplasmin-2

SCOPe Domain Sequences for d3t30c_:

Sequence, based on SEQRES records: (download)

>d3t30c_ b.121.3.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ttvlwgcelsqerrtwtfrpqlegkqscrlllhticlgekakeemhrveilppanqedkk
mqpvtiaslqasvlpmvsmvgvqlsppvtfqlragsgpvflsgqery

Sequence, based on observed residues (ATOM records): (download)

>d3t30c_ b.121.3.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ttvlwgcelsqerrtwtfrpqscrlllhticlgekakeemhrveilppmqpvtiaslqas
vlpmvsmvgvqlsppvtfqlragsgpvflsgqery

SCOPe Domain Coordinates for d3t30c_:

Click to download the PDB-style file with coordinates for d3t30c_.
(The format of our PDB-style files is described here.)

Timeline for d3t30c_: