Class b: All beta proteins [48724] (174 folds) |
Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies) sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies |
Superfamily b.121.3: Nucleoplasmin-like core domain [69203] (2 families) oligomerizes into a pentameric ring structure |
Family b.121.3.0: automated matches [191665] (1 protein) not a true family |
Protein automated matches [191264] (1 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [189827] (1 PDB entry) |
Domain d3t30a_: 3t30 A: [185622] automated match to d1k5ja_ |
PDB Entry: 3t30 (more details), 1.9 Å
SCOPe Domain Sequences for d3t30a_:
Sequence, based on SEQRES records: (download)
>d3t30a_ b.121.3.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} tvlwgcelsqerrtwtfrpqlegkqscrlllhticlgekakeemhrveilppanqedkkm qpvtiaslqasvlpmvsmvgvqlsppvtfqlragsgpvflsgqer
>d3t30a_ b.121.3.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} tvlwgcelsqerrtwtfrpcrlllhticlgekakeemhrveilppanmqpvtiaslqasv lpmvsmvgvqlsppvtfqlragsgpvflsgqer
Timeline for d3t30a_: