SCOPe 2.06: Domain d3t2tb_: 3t2t B:

Lineage for d3t2tb_ (3t2t B:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families)

5. Family b.29.1.3: Galectin (animal S-lectin) [49932] (9 proteins)

6. Protein Galectin-1 [100925] (5 species)

7. Species Human (Homo sapiens) [TaxId:9606] [101638] (27 PDB entries)
   Uniprot P09382

8. Domain d3t2tb_: 3t2t B: [185621]
   automated match to d1gzwa_
   complexed with mqt

Details for d3t2tb_

PDB Entry: 3t2t, 1.9 Å

PDB Description: crystal structure of human galectin-1 in complex with methyl 2-o- acetyl-3-o-toluoyl-beta-d-talopyranoside

PDB Compounds: (B:) galectin-1

SCOPe Domain Sequences for d3t2tb_:

Sequence; same for both SEQRES and ATOM records:

>d3t2tb_ b.29.1.3 (B:) Galectin-1 {Human (Homo sapiens) [TaxId: 9606]}
acglvasnlnlkpgeclrvrgevapdaksfvlnlgkdsnnlclhfnprfnahgdantivc
nskdggawgteqreavfpfqpgsvaevcitfdqanltvklpdgyefkfpnrlnleainym
aadgdfkikcvafd

Timeline for d3t2tb_:

• d3t2tb_ first appeared in SCOPe 2.01
  
• d3t2tb_ appears in SCOPe 2.05
  
• d3t2tb_ appears in SCOPe 2.07
  
• d3t2tb_ appears in the current release, SCOPe 2.08