Lineage for d3t28a_ (3t28 A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2794584Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2794585Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2794859Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)
  6. 2795997Protein Trypsin(ogen) [50515] (9 species)
  7. 2796015Species Cow (Bos taurus) [TaxId:9913] [50516] (500 PDB entries)
    Uniprot P00760
  8. 2796541Domain d3t28a_: 3t28 A: [185616]
    automated match to d1aq7a_
    complexed with ben, ca, tmo

Details for d3t28a_

PDB Entry: 3t28 (more details), 2.8 Å

PDB Description: tmao-grown trypsin (bovine)-previously unreported tetragonal crystal form
PDB Compounds: (A:) cationic trypsin

SCOPe Domain Sequences for d3t28a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3t28a_ b.47.1.2 (A:) Trypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]}
ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn

SCOPe Domain Coordinates for d3t28a_:

Click to download the PDB-style file with coordinates for d3t28a_.
(The format of our PDB-style files is described here.)

Timeline for d3t28a_: