Lineage for d3t0ha_ (3t0h A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2537076Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
    8-stranded mixed beta-sheet; 2 layers: alpha/beta
  4. 2537077Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families) (S)
  5. 2537078Family d.122.1.1: Heat shock protein 90, HSP90, N-terminal domain [55875] (2 proteins)
  6. 2537320Protein automated matches [190229] (12 species)
    not a true protein
  7. 2537333Species Human (Homo sapiens) [TaxId:9606] [187292] (142 PDB entries)
  8. 2537334Domain d3t0ha_: 3t0h A: [185605]
    automated match to d1osfa_

Details for d3t0ha_

PDB Entry: 3t0h (more details), 1.2 Å

PDB Description: Structure insights into mechanisms of ATP hydrolysis and the activation of human Hsp90
PDB Compounds: (A:) Heat shock protein HSP 90-alpha

SCOPe Domain Sequences for d3t0ha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3t0ha_ d.122.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
evetfafqaeiaqlmsliintfysnkeiflrelisnssdaldkiryesltdpskldsgke
lhinlipnkqdrtltivdtgigmtkadlinnlgtiaksgtkafmealqagadismigqfg
vgfysaylvaekvtvitkhnddeqyawessaggsftvrtdtgepmgrgtkvilhlkedqt
eyleerrikeivkkhsqfigypitlfvek

SCOPe Domain Coordinates for d3t0ha_:

Click to download the PDB-style file with coordinates for d3t0ha_.
(The format of our PDB-style files is described here.)

Timeline for d3t0ha_: