SCOPe 2.06: Domain d3t01a_: 3t01 A:

Lineage for d3t01a_ (3t01 A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.76: Alkaline phosphatase-like [53648] (1 superfamily)
   core:3 layers: a/b/a; mixed beta-sheet of 8 strands, order 43516728, strand 7 is antiparallel to the rest

4. Superfamily c.76.1: Alkaline phosphatase-like [53649] (6 families)

5. Family c.76.1.0: automated matches [191663] (1 protein)
   not a true family

6. Protein automated matches [191256] (1 species)
   not a true protein

7. Species Sinorhizobium meliloti [TaxId:266834] [189799] (5 PDB entries)

8. Domain d3t01a_: 3t01 A: [185600]
   automated match to d1ei6a_
   complexed with ppf, zn

Details for d3t01a_

PDB Entry: 3t01, 1.6 Å

PDB Description: crystal structure of phosphonoacetate hydrolase from sinorhizobium meliloti 1021 in complex with phosphonoformate

PDB Compounds: (A:) phosphonoacetate hydrolase

SCOPe Domain Sequences for d3t01a_:

Sequence; same for both SEQRES and ATOM records:

>d3t01a_ c.76.1.0 (A:) automated matches {Sinorhizobium meliloti [TaxId: 266834]}
mskisvtvngrrypwprvpaiavcldgcepayldaaidaglmpalkrikergavrlahsv
ipsftnpnnlsiatgsppavhgicgnylyepstgeevmmndpkflraptifqafydagar
vavvtakdklrallgkglrfdegravcfsseksdkatraehgidnasawlgrpvpevysa
alsefvfaagvkllrefrpdimyltttdyvqhkyapgvpeansfyemfdrylaeldglga
aivvtadhgmkpkhkadgspdviyvqdlldewlgkdaarvilpitdpyvvhhgalgsfat
aylpdgcdrseimarlkaiqgvdvvlgreeacrrfelpedrigdivlvssenktlgtseh
rhdlaaldeplrshgglteqevpfivnrvlpelpnaprlrnfdaffyavtaaa

Timeline for d3t01a_:

• d3t01a_ first appeared in SCOPe 2.01
  
• d3t01a_ appears in SCOPe 2.05
  
• d3t01a_ appears in SCOPe 2.07
  
• d3t01a_ appears in the current release, SCOPe 2.08