Lineage for d3szya_ (3szy A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2905606Fold c.76: Alkaline phosphatase-like [53648] (1 superfamily)
    core:3 layers: a/b/a; mixed beta-sheet of 8 strands, order 43516728, strand 7 is antiparallel to the rest
  4. 2905607Superfamily c.76.1: Alkaline phosphatase-like [53649] (6 families) (S)
  5. 2905783Family c.76.1.0: automated matches [191663] (1 protein)
    not a true family
  6. 2905784Protein automated matches [191256] (1 species)
    not a true protein
  7. 2905785Species Sinorhizobium meliloti [TaxId:266834] [189799] (5 PDB entries)
  8. 2905786Domain d3szya_: 3szy A: [185597]
    automated match to d1ei6a_
    complexed with zn

Details for d3szya_

PDB Entry: 3szy (more details), 1.35 Å

PDB Description: crystal structure of phosphonoacetate hydrolase from sinorhizobium meliloti 1021 in apo form
PDB Compounds: (A:) phosphonoacetate hydrolase

SCOPe Domain Sequences for d3szya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3szya_ c.76.1.0 (A:) automated matches {Sinorhizobium meliloti [TaxId: 266834]}
mskisvtvngrrypwprvpaiavcldgcepayldaaidaglmpalkrikergavrlahsv
ipsftnpnnlsiatgsppavhgicgnylyepstgeevmmndpkflraptifqafydagar
vavvtakdklrallgkglrfdegravcfsseksdkatraehgidnasawlgrpvpevysa
alsefvfaagvkllrefrpdimyltttdyvqhkyapgvpeansfyemfdrylaeldglga
aivvtadhgmkpkhkadgspdviyvqdlldewlgkdaarvilpitdpyvvhhgalgsfat
aylpdgcdrseimarlkaiqgvdvvlgreeacrrfelpedrigdivlvssenktlgtseh
rhdlaaldeplrshgglteqevpfivnrvlpelpnaprlrnfdaffyavtaaa

SCOPe Domain Coordinates for d3szya_:

Click to download the PDB-style file with coordinates for d3szya_.
(The format of our PDB-style files is described here.)

Timeline for d3szya_: