![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.76: Alkaline phosphatase-like [53648] (1 superfamily) core:3 layers: a/b/a; mixed beta-sheet of 8 strands, order 43516728, strand 7 is antiparallel to the rest |
![]() | Superfamily c.76.1: Alkaline phosphatase-like [53649] (6 families) ![]() |
![]() | Family c.76.1.0: automated matches [191663] (1 protein) not a true family |
![]() | Protein automated matches [191256] (1 species) not a true protein |
![]() | Species Sinorhizobium meliloti [TaxId:266834] [189799] (5 PDB entries) |
![]() | Domain d3szya_: 3szy A: [185597] automated match to d1ei6a_ complexed with zn |
PDB Entry: 3szy (more details), 1.35 Å
SCOPe Domain Sequences for d3szya_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3szya_ c.76.1.0 (A:) automated matches {Sinorhizobium meliloti [TaxId: 266834]} mskisvtvngrrypwprvpaiavcldgcepayldaaidaglmpalkrikergavrlahsv ipsftnpnnlsiatgsppavhgicgnylyepstgeevmmndpkflraptifqafydagar vavvtakdklrallgkglrfdegravcfsseksdkatraehgidnasawlgrpvpevysa alsefvfaagvkllrefrpdimyltttdyvqhkyapgvpeansfyemfdrylaeldglga aivvtadhgmkpkhkadgspdviyvqdlldewlgkdaarvilpitdpyvvhhgalgsfat aylpdgcdrseimarlkaiqgvdvvlgreeacrrfelpedrigdivlvssenktlgtseh rhdlaaldeplrshgglteqevpfivnrvlpelpnaprlrnfdaffyavtaaa
Timeline for d3szya_: