Lineage for d3szab_ (3sza B:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2515970Fold c.82: ALDH-like [53719] (1 superfamily)
    consists of two similar domains with 3 layers (a/b/a) each; duplication
    core: parallel beta-sheet of 5 strands, order 32145
  4. 2515971Superfamily c.82.1: ALDH-like [53720] (3 families) (S)
    binds NAD differently from other NAD(P)-dependent oxidoreductases
  5. 2515972Family c.82.1.1: ALDH-like [53721] (6 proteins)
  6. 2516294Protein automated matches [190401] (5 species)
    not a true protein
  7. 2516295Species Human (Homo sapiens) [TaxId:9606] [189906] (28 PDB entries)
  8. 2516300Domain d3szab_: 3sza B: [185594]
    automated match to d1ad3a_
    complexed with act, k

Details for d3szab_

PDB Entry: 3sza (more details), 1.48 Å

PDB Description: crystal structure of human aldh3a1 - apo form
PDB Compounds: (B:) Aldehyde dehydrogenase, dimeric NADP-preferring

SCOPe Domain Sequences for d3szab_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3szab_ c.82.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
skiseavkraraafssgrtrplqfriqqlealqrliqeqeqelvgalaadlhknewnayy
eevvyvleeieymiqklpewaadepvektpqtqqdelyihseplgvvlvigtwnypfnlt
iqpmvgaiaagnavvlkpselsenmasllatiipqyldkdlypvinggvpettellkerf
dhilytgstgvgkiimtaaakhltpvtlelggkspcyvdkncdldvacrriawgkfmnsg
qtcvapdyilcdpsiqnqiveklkkslkefygedakksrdygriisarhfqrvmgliegq
kvayggtgdaatryiaptiltdvdpqspvmqeeifgpvlpivcvrsleeaiqfinqrekp
lalymfssndkvikkmiaetssggvaandvivhitlhslpfggvgnsgmgsyhgkksfet
fshrrsclvrplmndeglkvryppspakmtqh

SCOPe Domain Coordinates for d3szab_:

Click to download the PDB-style file with coordinates for d3szab_.
(The format of our PDB-style files is described here.)

Timeline for d3szab_: