![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.82: ALDH-like [53719] (1 superfamily) consists of two similar domains with 3 layers (a/b/a) each; duplication core: parallel beta-sheet of 5 strands, order 32145 |
![]() | Superfamily c.82.1: ALDH-like [53720] (3 families) ![]() binds NAD differently from other NAD(P)-dependent oxidoreductases |
![]() | Family c.82.1.1: ALDH-like [53721] (6 proteins) |
![]() | Protein Aldehyde reductase (dehydrogenase), ALDH [53722] (9 species) |
![]() | Species Human (Homo sapiens), mitochondrial [TaxId:9606] [53726] (27 PDB entries) Uniprot P05091 |
![]() | Domain d3sz9f_: 3sz9 F: [185590] automated match to d1bi9a_ complexed with edo, gai, i3e, na |
PDB Entry: 3sz9 (more details), 2.1 Å
SCOPe Domain Sequences for d3sz9f_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3sz9f_ c.82.1.1 (F:) Aldehyde reductase (dehydrogenase), ALDH {Human (Homo sapiens), mitochondrial [TaxId: 9606]} avpapnqqpevfcnqifinnewhdavsrktfptvnpstgevicqvaegdkedvdkavkaa raafqlgspwrrmdashrgrllnrladlierdrtylaaletldngkpyvisylvdldmvl kclryyagwadkyhgktipidgdffsytrhepvgvcgqiipwnfpllmqawklgpalatg nvvvmkvaeqtpltalyvanlikeagfppgvvnivpgfgptagaaiashedvdkvaftgs teigrviqvaagssnlkrvtlelggkspniimsdadmdwaveqahfalffnqgqcccags rtfvqediydefversvaraksrvvgnpfdskteqgpqvdetqfkkilgyintgkqegak llcgggiaadrgyfiqptvfgdvqdgmtiakeeifgpvmqilkfktieevvgrannstyg laaavftkdldkanylsqalqagtvwvncydvfgaqspfggykmsgsgrelgeyglqayt evktvtvkvpqkns
Timeline for d3sz9f_: