Lineage for d1cs0c1 (1cs0 C:403-555)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2719912Fold a.92: Carbamoyl phosphate synthetase, large subunit connection domain [48107] (1 superfamily)
    multihelical; consists of two all-alpha subdomains
    possible duplication: subdomains have similar topologies
  4. 2719913Superfamily a.92.1: Carbamoyl phosphate synthetase, large subunit connection domain [48108] (1 family) (S)
    automatically mapped to Pfam PF02787
  5. 2719914Family a.92.1.1: Carbamoyl phosphate synthetase, large subunit connection domain [48109] (1 protein)
  6. 2719915Protein Carbamoyl phosphate synthetase, large subunit connection domain [48110] (1 species)
  7. 2719916Species Escherichia coli [TaxId:562] [48111] (10 PDB entries)
    Uniprot P00968
  8. 2719930Domain d1cs0c1: 1cs0 C:403-555 [18559]
    Other proteins in same PDB: d1cs0a2, d1cs0a3, d1cs0a4, d1cs0a5, d1cs0a6, d1cs0b1, d1cs0b2, d1cs0c2, d1cs0c3, d1cs0c4, d1cs0c5, d1cs0c6, d1cs0d1, d1cs0d2, d1cs0e2, d1cs0e3, d1cs0e4, d1cs0e5, d1cs0e6, d1cs0f1, d1cs0f2, d1cs0g2, d1cs0g3, d1cs0g4, d1cs0g5, d1cs0g6, d1cs0h1, d1cs0h2
    complexed with adp, cl, k, mn, net, orn, po4

Details for d1cs0c1

PDB Entry: 1cs0 (more details), 2 Å

PDB Description: crystal structure of carbamoyl phosphate synthetase complexed at cys269 in the small subunit with the tetrahedral mimic l-glutamate gamma-semialdehyde
PDB Compounds: (C:) carbamoyl phosphate synthetase: large subunit

SCOPe Domain Sequences for d1cs0c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cs0c1 a.92.1.1 (C:403-555) Carbamoyl phosphate synthetase, large subunit connection domain {Escherichia coli [TaxId: 562]}
evgatgfdpkvslddpealtkirrelkdagadriwyiadafraglsvdgvfnltnidrwf
lvqieelvrleekvaevgitglnadflrqlkrkgfadarlaklagvreaeirklrdqydl
hpvykrvdtcaaefatdtaymystyeeeceanp

SCOPe Domain Coordinates for d1cs0c1:

Click to download the PDB-style file with coordinates for d1cs0c1.
(The format of our PDB-style files is described here.)

Timeline for d1cs0c1: