Lineage for d3sxua_ (3sxu A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2922896Fold c.128: DNA polymerase III chi subunit [102399] (1 superfamily)
    3 layers, a/b/a; parallel beta-sheet of 7 strands, order 7165243
  4. 2922897Superfamily c.128.1: DNA polymerase III chi subunit [102400] (1 family) (S)
    structural similarity and possible evolutionary relationship to the AAA domain; lacks the P-loop motif
    automatically mapped to Pfam PF04364
  5. 2922898Family c.128.1.1: DNA polymerase III chi subunit [102401] (2 proteins)
  6. 2922903Protein automated matches [191263] (1 species)
    not a true protein
  7. 2922904Species Escherichia coli K-12 [TaxId:83333] [189826] (1 PDB entry)
  8. 2922905Domain d3sxua_: 3sxu A: [185580]
    automated match to d1em8a_

Details for d3sxua_

PDB Entry: 3sxu (more details), 1.85 Å

PDB Description: Structure of the E. coli SSB-DNA polymerase III interface
PDB Compounds: (A:) DNA polymerase III subunit chi

SCOPe Domain Sequences for d3sxua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3sxua_ c.128.1.1 (A:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
knatfylldndttvdglsaveqlvceiaaerwrsgkrvliacedekqayrldealwarpa
esfvphnlagegprggapveiawpqkrsssrrdilislrtsfadfataftevvdfvpyed
slkqlarerykayrvagfnlntatwk

SCOPe Domain Coordinates for d3sxua_:

Click to download the PDB-style file with coordinates for d3sxua_.
(The format of our PDB-style files is described here.)

Timeline for d3sxua_: