SCOPe 2.07: Domain d3sxua_: 3sxu A:

Lineage for d3sxua_ (3sxu A:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.128: DNA polymerase III chi subunit [102399] (1 superfamily)
   3 layers, a/b/a; parallel beta-sheet of 7 strands, order 7165243

4. Superfamily c.128.1: DNA polymerase III chi subunit [102400] (1 family)
   structural similarity and possible evolutionary relationship to the AAA domain; lacks the P-loop motif
   automatically mapped to Pfam PF04364

5. Family c.128.1.1: DNA polymerase III chi subunit [102401] (2 protein domains)

6. Protein automated matches [191263] (1 species)
   not a true protein

7. Species Escherichia coli K-12 [TaxId:83333] [189826] (1 PDB entry)

8. Domain d3sxua_: 3sxu A: [185580]
   automated match to d1em8a_

Details for d3sxua_

PDB Entry: 3sxu, 1.85 Å

PDB Description: Structure of the E. coli SSB-DNA polymerase III interface

PDB Compounds: (A:) DNA polymerase III subunit chi

SCOPe Domain Sequences for d3sxua_:

Sequence; same for both SEQRES and ATOM records:

>d3sxua_ c.128.1.1 (A:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
knatfylldndttvdglsaveqlvceiaaerwrsgkrvliacedekqayrldealwarpa
esfvphnlagegprggapveiawpqkrsssrrdilislrtsfadfataftevvdfvpyed
slkqlarerykayrvagfnlntatwk

Timeline for d3sxua_:

• d3sxua_ first appeared in SCOPe 2.01
  
• d3sxua_ appears in SCOPe 2.06