![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.128: DNA polymerase III chi subunit [102399] (1 superfamily) 3 layers, a/b/a; parallel beta-sheet of 7 strands, order 7165243 |
![]() | Superfamily c.128.1: DNA polymerase III chi subunit [102400] (1 family) ![]() structural similarity and possible evolutionary relationship to the AAA domain; lacks the P-loop motif automatically mapped to Pfam PF04364 |
![]() | Family c.128.1.1: DNA polymerase III chi subunit [102401] (2 proteins) |
![]() | Protein automated matches [191263] (1 species) not a true protein |
![]() | Species Escherichia coli K-12 [TaxId:83333] [189826] (1 PDB entry) |
![]() | Domain d3sxua_: 3sxu A: [185580] automated match to d1em8a_ |
PDB Entry: 3sxu (more details), 1.85 Å
SCOPe Domain Sequences for d3sxua_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3sxua_ c.128.1.1 (A:) automated matches {Escherichia coli K-12 [TaxId: 83333]} knatfylldndttvdglsaveqlvceiaaerwrsgkrvliacedekqayrldealwarpa esfvphnlagegprggapveiawpqkrsssrrdilislrtsfadfataftevvdfvpyed slkqlarerykayrvagfnlntatwk
Timeline for d3sxua_: