Lineage for d1c30g1 (1c30 G:403-555)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 541046Fold a.92: Carbamoyl phosphate synthetase, large subunit connection domain [48107] (1 superfamily)
    multihelical; consists of two all-alpha subdomains
    possible duplication: subdomains have similar topologies
  4. 541047Superfamily a.92.1: Carbamoyl phosphate synthetase, large subunit connection domain [48108] (1 family) (S)
  5. 541048Family a.92.1.1: Carbamoyl phosphate synthetase, large subunit connection domain [48109] (1 protein)
  6. 541049Protein Carbamoyl phosphate synthetase, large subunit connection domain [48110] (1 species)
  7. 541050Species Escherichia coli [TaxId:562] [48111] (10 PDB entries)
  8. 541058Domain d1c30g1: 1c30 G:403-555 [18557]
    Other proteins in same PDB: d1c30a2, d1c30a3, d1c30a4, d1c30a5, d1c30a6, d1c30b1, d1c30b2, d1c30c2, d1c30c3, d1c30c4, d1c30c5, d1c30c6, d1c30d1, d1c30d2, d1c30e2, d1c30e3, d1c30e4, d1c30e5, d1c30e6, d1c30f1, d1c30f2, d1c30g2, d1c30g3, d1c30g4, d1c30g5, d1c30g6, d1c30h1, d1c30h2

Details for d1c30g1

PDB Entry: 1c30 (more details), 2 Å

PDB Description: crystal structure of carbamoyl phosphate synthetase: small subunit mutation c269s

SCOP Domain Sequences for d1c30g1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c30g1 a.92.1.1 (G:403-555) Carbamoyl phosphate synthetase, large subunit connection domain {Escherichia coli}
evgatgfdpkvslddpealtkirrelkdagadriwyiadafraglsvdgvfnltnidrwf
lvqieelvrleekvaevgitglnadflrqlkrkgfadarlaklagvreaeirklrdqydl
hpvykrvdtcaaefatdtaymystyeeeceanp

SCOP Domain Coordinates for d1c30g1:

Click to download the PDB-style file with coordinates for d1c30g1.
(The format of our PDB-style files is described here.)

Timeline for d1c30g1: