Lineage for d3svma_ (3svm A:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1309919Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 1311416Superfamily b.34.13: Chromo domain-like [54160] (4 families) (S)
    SH3-like barrel is capped by a C-terminal helix
  5. 1311567Family b.34.13.0: automated matches [191621] (1 protein)
    not a true family
  6. 1311568Protein automated matches [191139] (2 species)
    not a true protein
  7. 1311572Species Human (Homo sapiens) [TaxId:9606] [189257] (6 PDB entries)
  8. 1311582Domain d3svma_: 3svm A: [185563]
    automated match to d2dnta1

Details for d3svma_

PDB Entry: 3svm (more details), 2.31 Å

PDB Description: Human MPP8 - human DNMT3AK47me2 peptide
PDB Compounds: (A:) M-phase phosphoprotein 8

SCOPe Domain Sequences for d3svma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3svma_ b.34.13.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
edvfevekildmkteggkvlykvrwkgytsdddtwepeihledckevllefrkkiaenka

SCOPe Domain Coordinates for d3svma_:

Click to download the PDB-style file with coordinates for d3svma_.
(The format of our PDB-style files is described here.)

Timeline for d3svma_: